PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G078000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 359aa    MW: 38719.3 Da    PI: 5.758
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G078000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-073083402254
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +yp++e++++L +++gL+ +q+ +WF N+R +
  Brast03G078000.1.p 308 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 340
                         69*****************************87 PP

2ELK285.1e-10261282122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELKh+L+++Y+++L+++++E++
  Brast03G078000.1.p 261 ELKHELKQGYKEKLVDIREEIL 282
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-1895139IPR005540KNOX1
PfamPF037901.4E-1698138IPR005540KNOX1
SMARTSM012564.0E-28149205IPR005541KNOX2
PfamPF037911.6E-18157204IPR005541KNOX2
SMARTSM011889.2E-4261282IPR005539ELK domain
PROSITE profilePS5121310.144261281IPR005539ELK domain
PfamPF037891.8E-6261282IPR005539ELK domain
PROSITE profilePS5007111.774281344IPR001356Homeobox domain
SuperFamilySSF466894.28E-16283347IPR009057Homeodomain-like
SMARTSM003891.1E-10283348IPR001356Homeobox domain
CDDcd000869.02E-12284345No hitNo description
Gene3DG3DSA:1.10.10.609.0E-25288345IPR009057Homeodomain-like
PfamPF059209.4E-18301340IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAFHGHLPHE MAMLPPLGAD DAAAAAAAAG GGGAPPAWMR QYGGDGSFLH LQQTTSDSSP  60
SAAAGVQWIG AGGEEAVAAA MGGGGGMAVE EAEAARSKAE VLAHPLYEQL LSAHVACLRI  120
ATPVDQLPRI DAQLAQSQGV VAKYSSTGGG LAAGDDTREL DQFMTHYVLL LCSFKEQLQQ  180
HVRVHAMEAV MACWELEQNL QSLTGVSPGE GTGATMSDGE DDQADSEANM YDASLDGPDS  240
MGGFGLPTES ERSLMERVRQ ELKHELKQGY KEKLVDIREE ILRKRRAGKL PGDTTSTLKS  300
WWQSHSKWPY PTEEDKARLV QETGLQLKQI NNWFINQRKR NWHSNPSSST NVKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A8e-13284348872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337357RKRNWHSNPSSSTNVKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234555.20.0PREDICTED: homeobox protein knotted-1-like 13 isoform X1
SwissprotQ0J6N40.0KNOSD_ORYSJ; Homeobox protein knotted-1-like 13
TrEMBLI1I2N30.0I1I2N3_BRADI; Uncharacterized protein
STRINGBRADI3G19927.40.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-162KNOTTED1-like homeobox gene 3